Protein Info for BPHYT_RS21925 in Burkholderia phytofirmans PsJN

Annotation: formimidoylglutamase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR01227: formimidoylglutamase" amino acids 10 to 318 (309 residues), 296.1 bits, see alignment E=1.5e-92 PF00491: Arginase" amino acids 43 to 319 (277 residues), 181.2 bits, see alignment E=1.5e-57

Best Hits

Swiss-Prot: 100% identical to HUTG_PARPJ: Formimidoylglutamase (hutG) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01479, formiminoglutamase [EC: 3.5.3.8] (inferred from 100% identity to bpy:Bphyt_4413)

Predicted SEED Role

"Formiminoglutamase (EC 3.5.3.8)" in subsystem Histidine Degradation (EC 3.5.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFB8 at UniProt or InterPro

Protein Sequence (320 amino acids)

>BPHYT_RS21925 formimidoylglutamase (Burkholderia phytofirmans PsJN)
MRVPFDDKMWAGRSDDGEPGDTRRVFNQIVPFDGSLRAHGDTTVVVGFGSDEGVRRNQGR
TGAAHAPKELRRALAGLPAKNSMAMLADAGDVACDDGDLEGAQAELANVISEVLASGGRP
LVFGGGHEVAWATYCGLVLHQHRREADESATPRKLLIINFDAHFDLRQKRPANSGTPFDQ
IANDCAERRVPFNYVCFGISDLGNTASLFVHAQRLGVRYALDVDMQETQLPLRLQELDLM
LDEADDVYLTIDLDVLPAATAPGVSAPAALGVPLFVVEEMVRRVRGSGKLRAADIAEYNP
SLDQDRRTARAAARLAYRLL