Protein Info for BPHYT_RS21780 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 48 to 72 (25 residues), see Phobius details amino acids 79 to 107 (29 residues), see Phobius details amino acids 109 to 110 (2 residues), see Phobius details amino acids 148 to 161 (14 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 378 (361 residues), 192.5 bits, see alignment E=1.5e-60 amino acids 295 to 426 (132 residues), 38.9 bits, see alignment E=8e-14 PF06779: MFS_4" amino acids 37 to 409 (373 residues), 27.8 bits, see alignment E=2.5e-10 PF00083: Sugar_tr" amino acids 46 to 193 (148 residues), 34.7 bits, see alignment E=1.5e-12

Best Hits

Swiss-Prot: 75% identical to SAUU_CUPNH: Probable sulfoacetate transporter SauU (sauU) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4384)

Predicted SEED Role

"Probable glucarate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF90 at UniProt or InterPro

Protein Sequence (460 amino acids)

>BPHYT_RS21780 MFS transporter (Burkholderia phytofirmans PsJN)
METRIRRVKTRHIILAVMCLMYFISYIDRVNIAVAGPLIRHEMGLTTVQLGLVFSAFAYP
YAAMQIIGGWLADKYGPKLVLTVLSLIWGVATLATGFAGSVTMLVVMRFALGIGEGGAFP
TATRAFTYWMPVAERGFAQGITHSFARLGGAITPPLVLAVVATGGWRDAFILLGIASLAW
TVLYLFVFTNSPEQNRRITPEETAEIGYRAGDCDRAKHAATPWRKLVRRMWLVTFVDFCY
GWLLWVYLTWLPSYLRESRGFDLKQLALFTALPLLAGVIGDTLGGVVSDKLYKITGRLRF
ARCTVLVVGMGGSLVFLLPMVSATNPLTAVWFLSASFFFLEITNPVLWTLPLDIAGKYAG
TAGGMMNTGFGVAGMVSPVVFGYLIEKTGSYNVPFNISAGLLAVGILAALFIDTSKTVEA
DEERERAAGVELGGMPSFSHAGAGVRLERHHLRRPLRWRK