Protein Info for BPHYT_RS21770 in Burkholderia phytofirmans PsJN

Annotation: aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF00171: Aldedh" amino acids 13 to 282 (270 residues), 79.2 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 73% identical to SAUS_CUPNH: Sulfoacetaldehyde dehydrogenase (acylating) (sauS) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4382)

MetaCyc: 73% identical to sulfoacetaldehyde dehydrogenase (acylating) subunit (Cupriavidus necator H16)
RXN-11674 [EC: 1.2.1.81]

Predicted SEED Role

"Aldehyde dehydrogenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF88 at UniProt or InterPro

Protein Sequence (481 amino acids)

>BPHYT_RS21770 aldehyde dehydrogenase (Burkholderia phytofirmans PsJN)
MNVRATGAEISGTHADGEAERIVATLVAKARAAQRAFEQAGQQALDTAADAAAWAIMEPE
RNRQLAERAVHDTGLGNADDKFRKNYRKTLGLLRDLHEQKTTGVIAEDKASGLVEIARAV
GVVAAITPSTNPAATPANKIINALKCGNAVIVAPSPKGYSSCALLIEFIHAQFAKAGIDP
DLVQMLPAPISKAATAALMRQCDLVVATGSQANVRMAYASGTPAFGVGAGNVASIVTASA
DLHDAARKILRSKTFDNATSCSSENSIVIEEAVYQPMLAELTSCGGVLLDAAQKAKLQTA
MWVNGKLSEQCTAKSAEVIARVAGLEEVAARHPAFLMVEESGAGSDYPFSGEKLAPVLTV
YRAAGFDAAAEVVRSIYAYMGAGHSVGLHSSDAAQAVQLGVTLPVARVIVNQAHCLATGG
NFDNGLPFSLSMGCGTWGRNNFSGNLGFRHYLNTTRVAYPIEERVPETDELLGDFFARYG
R