Protein Info for BPHYT_RS21710 in Burkholderia phytofirmans PsJN

Annotation: DeoR faimly transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 TIGR03250: putative phosphonoacetaldehyde dehydrogenase" amino acids 5 to 476 (472 residues), 887 bits, see alignment E=1.3e-271 PF00171: Aldedh" amino acids 21 to 471 (451 residues), 476.1 bits, see alignment E=5e-147

Best Hits

Swiss-Prot: 57% identical to PHNY_RHIME: Phosphonoacetaldehyde dehydrogenase (phnY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4370)

MetaCyc: 57% identical to phosphonoacetaldehyde dehydrogenase (Sinorhizobium meliloti 1021)
1.2.1.-

Predicted SEED Role

"NAD-dependent aldehyde dehydrogenases"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF76 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BPHYT_RS21710 DeoR faimly transcriptional regulator (Burkholderia phytofirmans PsJN)
MPSAVRHEAMRIGGERVTRAEVIEVFNPYTRELVGTVPNATVDDVRHAFEYAHAYRAKLT
RYERAQILRRAADIVRERTNEIADLITAESGLCKKDSLYEAGRVSDVLVFGANEALKDDG
QIFSCDLTPHGKQRRVYTQREPLLGVICAITPFNHPMNQVAHKIVPSIATNNRIVVKPSE
KVPLSTCLLAEILYSAGLPQQMLQVVTGDPKDIADELITNPRVDLITFTGGVAIGKYIAN
KMGYRRAVLELGGNDPIIVMEDADLDEASTLAVSGSYKNSGQRCTAIKRMLVHEAVADRF
VELLVEKTRAIRYDDPADPATDMGTVIDEDSAKFFEAQVNDAVSRGAKLLLGNVRRGALY
SPTVVDHVTADMPLVRYETFGPVSPVIRFRDIDEAIRLSNSTDYGLSSSVCTNRLDYITR
FIAELEVGSVNVREVPGYRLELTPFGGIKDSGLGYKEGVQEAIKSFTNVKTYSLPWQ