Protein Info for BPHYT_RS21620 in Burkholderia phytofirmans PsJN

Annotation: GCN5 family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF00583: Acetyltransf_1" amino acids 42 to 130 (89 residues), 44.4 bits, see alignment E=2.8e-15 PF13508: Acetyltransf_7" amino acids 48 to 132 (85 residues), 34 bits, see alignment E=4.7e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4352)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF58 at UniProt or InterPro

Protein Sequence (155 amino acids)

>BPHYT_RS21620 GCN5 family acetyltransferase (Burkholderia phytofirmans PsJN)
MPASLRFVHLDTPELLLPAFDVMRQLRPHLTDAHSFAAQVARQHADGYRLLAASDASGIV
GLAGYRILTNLLYGRFVYVDDLVVDGKLQRDGIGAQLLDAVRQIAREAGCVQFVLDTGLH
MPLAQRFYFRNGLLARGMHFVEPLAPLSPASALTP