Protein Info for BPHYT_RS21530 in Burkholderia phytofirmans PsJN

Annotation: RNA polymerase subunit sigma-24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF04542: Sigma70_r2" amino acids 14 to 77 (64 residues), 44.6 bits, see alignment E=1.5e-15 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 17 to 174 (158 residues), 74.8 bits, see alignment E=3.1e-25 PF08281: Sigma70_r4_2" amino acids 119 to 159 (41 residues), 39.6 bits, see alignment 5e-14 PF04545: Sigma70_r4" amino acids 124 to 173 (50 residues), 26.4 bits, see alignment E=5.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4335)

Predicted SEED Role

"DNA-directed RNA polymerase specialized sigma subunit, sigma24-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF45 at UniProt or InterPro

Protein Sequence (184 amino acids)

>BPHYT_RS21530 RNA polymerase subunit sigma-24 (Burkholderia phytofirmans PsJN)
MTERDTDITATVVRERTRLVNFIRRRIRDPDDAEDILQDVFHEFVQAYRLPAPIEQASAW
LFRAARNRIVDRFRKKKEQPLADLSASGDDADSEYRLDLDLPAHDAGPEALYARALLLKA
LQDALDELPANQREVFVAHELEGRSFKEMAAESGVTLNTLLARKRYAVLHLRARLQAICD
ELGI