Protein Info for BPHYT_RS21355 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 354 to 378 (25 residues), see Phobius details amino acids 392 to 415 (24 residues), see Phobius details amino acids 425 to 447 (23 residues), see Phobius details PF06609: TRI12" amino acids 13 to 245 (233 residues), 36.4 bits, see alignment E=3.4e-13 PF07690: MFS_1" amino acids 15 to 405 (391 residues), 157.8 bits, see alignment E=5.3e-50 amino acids 269 to 447 (179 residues), 41.3 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 38% identical to HSRA_ECOLI: Probable transport protein HsrA (hsrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4300)

Predicted SEED Role

"Predicted trehalose permease, MFS family" in subsystem Trehalose Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TF06 at UniProt or InterPro

Protein Sequence (467 amino acids)

>BPHYT_RS21355 major facilitator transporter (Burkholderia phytofirmans PsJN)
MPLALGTFIVPLIVACAMFMENVDGTVIVTSLPVLARDLGQDPITLKLAVTAYVIGLGVF
IPICGWVADRFGSRTVFRAAIGVFMAGSLMCAASTSLGTFVVARFVQGIGGAMMVPVGRI
IIFRSVPKSDFIRAVNYLTVPALLGPVVGPPLGGFITTYLHWRLIFFINIPIGLLGIWLA
NKHIANVREAHPGRLDWTGFFLSASGASLFMLGLSLVGGELVSNTVSVGMCVIGVVLLTL
YALYASRVELPVLDLRLLRIPSFHASVVGGSLFRIGLGAVPFLLPLALQEGLGMTAFKSG
SITCASAFGSIFMKAAASRILERFGFRTVLMFNAGCAGLAIAVYGLFFPGTPHWLIWCVV
LFGGFFPSLQFTSLNTLAYADIPSRDVGRATSVASVIQQISLGLGVTIAGIVLQISHNVQ
GHSAIVFSDFWPAFLVVGLFSFMSIPITARLPHGAGDEIARGSRGNA