Protein Info for BPHYT_RS21130 in Burkholderia phytofirmans PsJN

Annotation: F420-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR01916: coenzyme F420-0:L-glutamate ligase" amino acids 8 to 259 (252 residues), 263.9 bits, see alignment E=6.6e-83 PF01996: F420_ligase" amino acids 16 to 235 (220 residues), 229.9 bits, see alignment E=1.4e-72

Best Hits

Swiss-Prot: 44% identical to COFE_METTH: Coenzyme F420:L-glutamate ligase (cofE) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)

KEGG orthology group: K12234, coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC: 6.3.2.31 6.3.2.34] (inferred from 100% identity to bpy:Bphyt_4255)

MetaCyc: 42% identical to F420-0:gamma-glutamyl ligase subunit (Methanocaldococcus jannaschii)
RXN-8081 [EC: 6.3.2.34]; RXN-8080 [EC: 6.3.2.34, 6.3.2.31]

Predicted SEED Role

"Coenzyme F420-0:L-glutamate ligase @ Coenzyme F420-1:L-glutamate ligase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.31 or 6.3.2.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEW3 at UniProt or InterPro

Protein Sequence (259 amino acids)

>BPHYT_RS21130 F420-dependent oxidoreductase (Burkholderia phytofirmans PsJN)
MNAGSNTMELVALPGIPGVREGDDVGDLVADAMARTGRQWQTGDIVVIAQKIVSKAEGRT
RRLADIYPSHMAWEYASVSDKDPRKVQAMLDESVDVVRVAKVGPDGLMITRHRHGWVCAN
AAIDESNVGEDGTMLLLPVDPDASAAEVARKLEARGGIKAGVIISDTFGRAWRRGLVNVA
IGAANVPVIVDWIGRVDAYGRPLQISQPAFADEVAAAAGLLMGKDSFTPVVLVRGLSWDI
DNGAHARQLVRPLEEDLFQ