Protein Info for BPHYT_RS21120 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01933: CofD
  • amino acids 10 to 273 (264 residues), 141.2 bits, E=2e-45

Best Hits

Swiss-Prot: 38% identical to COFD_MYCS2: 2-phospho-L-lactate transferase (cofD) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K11212, LPPG:FO 2-phospho-L-lactate transferase [EC: 2.7.8.28] (inferred from 100% identity to bpy:Bphyt_4253)

Predicted SEED Role

"Lactyl (2) diphospho-(5')guanosine:7,8-didemethyl-8-hydroxy-5-deazariboflavin 2-phospho-L-lactate transferase" in subsystem Coenzyme F420 synthesis

MetaCyc Pathways

• factor 420 biosynthesis I (archaea) (3/5 steps found)
• 3PG-factor 420 biosynthesis (2/5 steps found)
• factor 420 biosynthesis II (mycobacteria) (2/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.28

Sequence Analysis Tools

See B2TEW1 at UniProt or InterPro

Protein Sequence (276 amino acids)

>BPHYT_RS21120 hypothetical protein (Burkholderia phytofirmans PsJN)
MRDTGYPARIVLLAGGVGGARMALGLSAELATGSLSIVANIGDDEDFYGLRVCPDLDTLL
YTLSGKVDPMQGWGVEGDNTRALGVLGELGAPVWMKLGDADMGLHVWRTWRLAFGESLTS
VMAEASARFGVPGYLLPACDAPVPTEIVCDEGPLRFQQWFVAHRAAPPVREVRYCGAEDR
CATPEVLRAIEQADLIVIAPSNPLLSIEPMLALGGLREALQTSGAPCVAVSPLIGGKAVK
GPLDRMLDDMGLPGGNAGIAKRYEGLLHGLVIHTDD