Protein Info for BPHYT_RS21115 in Burkholderia phytofirmans PsJN

Annotation: radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR03551: 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit" amino acids 35 to 380 (346 residues), 489.7 bits, see alignment E=3.8e-151 TIGR00423: radical SAM domain protein, CofH subfamily" amino acids 69 to 379 (311 residues), 374.8 bits, see alignment E=3.4e-116 PF04055: Radical_SAM" amino acids 77 to 251 (175 residues), 63.6 bits, see alignment E=2.7e-21 PF19288: CofH_C" amino acids 260 to 380 (121 residues), 68 bits, see alignment E=7.2e-23

Best Hits

Swiss-Prot: 48% identical to COFH_METJA: 5-amino-6-(D-ribitylamino)uracil--L-tyrosine 4-hydroxyphenyl transferase (cofH) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K11779, FO synthase [EC: 2.5.1.-] (inferred from 100% identity to bpy:Bphyt_4252)

MetaCyc: 48% identical to 5-amino-6-(D-ribitylamino)uracil--L-tyrosine 4-methylphenol transferase (Methanocaldococcus jannaschii)
RXN-19229 [EC: 2.5.1.147]

Predicted SEED Role

"7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 2" in subsystem Coenzyme F420 synthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.147

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEW0 at UniProt or InterPro

Protein Sequence (423 amino acids)

>BPHYT_RS21115 radical SAM protein (Burkholderia phytofirmans PsJN)
MAARRNGDDPSALLSAASAPVRFILSRHLEGAEISRDEGRVLFEADGEDLKAVVATADHV
RRERVGDVVSFVVTRNINFTNVCYMGCRFCGFAKRREEEGAELLSMDEVARRADVARQRG
ATEVCIQGGLHPDLTDHHYLDILAAIKARVPEMHIHAFSPFEIWYGSKKRRQAAADYLRE
LKAAGLGSIPGTAAEILDTDVRRQLTRNKLSAQAWVEIVRAAHGVGLRSTSTMMYGHVDG
PGHWAAHIDLLRSIQKETGGFTEFVPLGFVHSEAPLYMEHEIPGVRAGATLVEHIKVHAI
ARLMLAGWIDNIQVSWVKLGPQTGQALLAAGANDFGGTLMDESISRSAGASFGEEITAAE
MVSIIRDAGREPVRRSTLYVPLERYVDHDPVALPPLKARAYDPIRFLRNRPQAGCDNEEL
AHA