Protein Info for BPHYT_RS21110 in Burkholderia phytofirmans PsJN
Annotation: FO synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to COFG_METKA: 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase (cofG) from Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
KEGG orthology group: K11779, FO synthase [EC: 2.5.1.-] (inferred from 100% identity to bpy:Bphyt_4251)Predicted SEED Role
"7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase subunit 1" in subsystem Coenzyme F420 synthesis
KEGG Metabolic Maps
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Methionine metabolism
- Porphyrin and chlorophyll metabolism
- Riboflavin metabolism
- Terpenoid biosynthesis
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.-
Use Curated BLAST to search for 2.5.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2TEV9 at UniProt or InterPro
Protein Sequence (386 amino acids)
>BPHYT_RS21110 FO synthase (Burkholderia phytofirmans PsJN) MLSRAEAIALDQVSAGELHQLMRRACRVREKAWGATVTYSRKVFIPLTNLCRDKCGYCTF ARQPDEPGAGYLAPDQVMAIARRGEALGCKEALFSLGEKPELVYPQARAVLDALGYATTM DYVIAMSERILAETSLIPHVNAGTLTRAEIVRLKAVCGSVGLMLENVSRRLVQRGMAHYA CPDKVPVQRLRTLDMAGVERIATTTGILIGIGETWVERIDSLLAIAELHTRHGHIQEVIV QNFRAKPGTMMATWNEPGHEDMLRTLAVARLLLPTDISLQAPPNLAEAFEDYLDSGINDW GGISPVTADYINPERAWPAIHDVARRSHGRGLGLAERLTVYPRYLCQPDFVGAAPARALG CQARPDGLALHQYEAMPMAASAECAA