Protein Info for BPHYT_RS21070 in Burkholderia phytofirmans PsJN

Annotation: ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 97 to 116 (20 residues), see Phobius details PF00175: NAD_binding_1" amino acids 102 to 197 (96 residues), 27.2 bits, see alignment E=5.3e-10 PF00111: Fer2" amino acids 232 to 305 (74 residues), 54.1 bits, see alignment E=1.3e-18

Best Hits

Swiss-Prot: 47% identical to POBB_PSEPS: Phenoxybenzoate dioxygenase subunit beta (pobB) from Pseudomonas pseudoalcaligenes

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4243)

MetaCyc: 46% identical to tetrachlorobenzoquinone reductase monomer (Sphingobium chlorophenolicum)
RXN-18404 [EC: 1.1.1.404]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.1.1.404 or 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEV1 at UniProt or InterPro

Protein Sequence (314 amino acids)

>BPHYT_RS21070 ferredoxin (Burkholderia phytofirmans PsJN)
MRGIRIEAETVRSFELWPVSGELPPFTAGAHIDVHLSHGMTRQYSLTNSLERHRYVIAVQ
RDPGGAGGSMSMHDSVALGSRLIVSAPRNYFPLNEAAVHSVLIAGGIGVTPLLAMVRRLC
QLGLSWDFYYCARVPARAAFLSELKELAATTYPDRALHCVFDGEAGVTSLNLGDVRAAHR
PDSDFYCCGPAPLMDAFSTTFASLPPERVHLEYFKAPVADTLGEAEGAFTVTLSRQGKTL
VVPPNRSILEVLRENGVPMLSSCRQGICGTCETRVVEGVPDHRDHVLTPAERASNQTMMI
CVSRCKGEALTLDI