Protein Info for BPHYT_RS21050 in Burkholderia phytofirmans PsJN

Annotation: aldehyde-activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02820: S-(hydroxymethyl)glutathione synthase
  • amino acids 5 to 184 (180 residues), 266.9 bits, E=4.3e-84

Best Hits

Swiss-Prot: 62% identical to GFA_XANAC: Glutathione-dependent formaldehyde-activating enzyme (gfa) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4238)

Predicted SEED Role

"Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 4.4.1.22)

MetaCyc Pathways

• formaldehyde oxidation II (glutathione-dependent) (3/3 steps found)
• superpathway of C1 compounds oxidation to CO₂ (5/12 steps found)

KEGG Metabolic Maps

• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.22

Use Curated BLAST to search for 4.4.1.22

Sequence Analysis Tools

See B2TEU3 at UniProt or InterPro

Protein Sequence (191 amino acids)

>BPHYT_RS21050 aldehyde-activating protein (Burkholderia phytofirmans PsJN)
MTRAIHLSVDHGIQKGASDFGGGTLRCSCTNDPVEVHVDTQVLYNHACGCTQCWKPEHTL
SSVVGVVPREKVAVTSHREKLKVRDDTALIQRDARTACGTHLYGRIENKERAFYGLDFIQ
TELSTEAGWDGPGFAPFVSSIIESGTAPSSMVEVRQTPREKGLEPYDCLSPALMDILAAH
SAKAKSTHSEA