Protein Info for BPHYT_RS21040 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 54 (22 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 15 to 278 (264 residues), 102.7 bits, see alignment E=1e-33

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_4235)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEU8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>BPHYT_RS21040 ABC transporter permease (Burkholderia phytofirmans PsJN)
MNLLFSWIGNVPDAAVPFALAALGLIVSERAGVLSLGAEGIMLVGALAGIGTQLTVHNAG
IALLMSMIAGGAISVLFAVMVVWLRVNQVIAGLALVFFCQGLTSLLGTLAGWINRPVSGL
QPIALGPVARLPLVGSLFNQNLVVYLTPLIFAVVTWYLNRTVGGLRLRSVGESPPAADAA
GVAVLRVRFLAIMAGSTLVGLAGGYISVAGTHMWIADMTGGRGWIAVALVIFARWSPGRA
LIGALLFGGIEALIPQMAAAGISMPQYYVLCAPYLITLAVMIQGAIVRRGSDETPCALGE
PYVREERR