Protein Info for BPHYT_RS21035 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 50 to 74 (25 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 308 to 340 (33 residues), see Phobius details amino acids 346 to 372 (27 residues), see Phobius details PF02653: BPD_transp_2" amino acids 95 to 366 (272 residues), 131.3 bits, see alignment E=1.9e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_4234)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEU7 at UniProt or InterPro

Protein Sequence (384 amino acids)

>BPHYT_RS21035 ABC transporter permease (Burkholderia phytofirmans PsJN)
MPDSALDGESSTSFASLEATPTPRRACRTSLLARRYALELRQETPRRKQAVVLAFSVTVG
LAVCVAILMTAGISASDLFNEFIVETLGDADNFRAVLFQAAPMVMVGLAAALSFRAKFWN
LGLEGQMVWGAIGATAVALADAGTPETRLWLMGAAALVCGALWTVLPLLLRMRLGISEII
STLMLNYVAANLLLNLVYGQWKDPRDSFPHSRNFLAAERLPSIASGYSSAILLAVLFALA
AWWFLHRSRAGIYVRFVNVNARAAEAMGVPVRNVVAGVVLLSGALAGFAGFTVTAAQAGR
LTQDFYSGYGFSGILIAFLARNNPIAASVVALLVAALFVTGRSLQVLYQIPFSMVQLIQA
ILVIVVAASDFFTRYRLSPVGVAE