Protein Info for BPHYT_RS20850 in Burkholderia phytofirmans PsJN

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 52 (23 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF00892: EamA" amino acids 141 to 278 (138 residues), 30.2 bits, see alignment E=2.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4193)

Predicted SEED Role

"Permeases of the drug/metabolite transporter (DMT) superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEQ4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>BPHYT_RS20850 multidrug DMT transporter permease (Burkholderia phytofirmans PsJN)
MLSYTGGLVLVAALLHASWNAMLHGNRDRFLSMTWMSIAIAAVATLAILFTPLPASAAWP
YLAASGLVHIVYNVSLVRAYRRGDLAQAYPIARGSSPLLVTLGAALFAHEAIGPLHALGI
AMISGGIIALALQGGRVSRVGALAALATGASIALYTVIDGIGVRLSGGEALAYTAWMFLF
YWLMPVLFVAMRGLAALWTPIRAAPIAVASSLAGGMVSIAAYGIVIWAMQSGAMGTVSAL
RETSVVFAVLIGRVILREAVSARRWLACVVVAAGAVCLGL