Protein Info for BPHYT_RS20820 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 50 to 82 (33 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 271 to 272 (2 residues), see Phobius details amino acids 284 to 310 (27 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 306 (264 residues), 94.4 bits, see alignment E=3.3e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4187)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEP8 at UniProt or InterPro

Protein Sequence (319 amino acids)

>BPHYT_RS20820 ABC transporter permease (Burkholderia phytofirmans PsJN)
MAQMNASLKARLGDNAPFIALIALYLLIEIAQPTFLAPSTQLGLLADSSTLFIMAAGTTF
VVLLGSIDLSLQAVASLSSVIVAMLLPRYGAWAAVVALAASFGIGLLSGVIQTVLRIPSF
IATLAVGGIASAAALTLSGTRSIGISDEMRNASLGWTTGSSFGMPHEIMLALVVFLLCVF
LHRSTVFGRHVDAIGAGEPAAIASGVRVPVTRCLVFATSSLFAGLAGVIMAGRLGSGSPT
LADQFLLPAIAAVIVGGTALTGGAGGVGRTLIGALLVSVARVGMTFVGISVFAQQIVFGV
ILIVAVTVAFDRSKVLIIK