Protein Info for BPHYT_RS20810 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 296 to 313 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 308 (269 residues), 112.3 bits, see alignment E=1.2e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4185)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEP6 at UniProt or InterPro

Protein Sequence (321 amino acids)

>BPHYT_RS20810 ABC transporter permease (Burkholderia phytofirmans PsJN)
MHGPAAVRALLRRYSPLLVLMALGLCIGVLNHDFFDPMNLSRIAIAAVIPLTIALGGTFV
IQLGSIDLSAEGIVAVAAIAVSMLVENSYNDNHFGLWVLAIGVAAGVVLGLANGVLHVFL
RIPSFITTLAVGFVATGIGTAVLSGNTIRVSDTALRAISITRYFGLPLSVWIGVLALGLA
WFVHRHTILGRHTLAIGGGEDLARLSGVRISRVRIAVFALAGAFYGVAGILAVAQYGQGH
AMIADGQLFVAITAIVVGGTSLAGGNGGPLNTLIGTLVVVVLANGMVLLGVPPYVQQGIQ
GVLIIVAVTLALNRSRRRIVK