Protein Info for BPHYT_RS20745 in Burkholderia phytofirmans PsJN

Annotation: ribose ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 275 to 306 (32 residues), see Phobius details amino acids 317 to 336 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 58 to 331 (274 residues), 155.1 bits, see alignment E=1.1e-49

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to bpy:Bphyt_4171)

Predicted SEED Role

"Possible fucose ABC transporter, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEN3 at UniProt or InterPro

Protein Sequence (341 amino acids)

>BPHYT_RS20745 ribose ABC transporter permease (Burkholderia phytofirmans PsJN)
MTSQSDTSALGNKKTFSGLRARVFTPTALQKLLAFGSLILLLVFFSFASPAFMQMDNMLG
ILQATAVNGVLAIACTFVIITGGIDLSVGTLMTFTAVICGVFLTYWHLPMWTGVLAAIGT
GAICGTVSGTLTAKMKIPPFIATLGMMMLLKGLSLVVSADKPIYFTDTENFYMISQDSLI
GDLLPSLPVPNAVLILFFLAVVSSITLNRTALGRYTFALGSNEEAVRLSGVNVDRWKIAI
YGLSGAICGIAGLLIASRLNSAQPALGQGYELEAIAAVVIGGTSLSGGAGTILGTIIGAF
IMSVLTNGLRIMSVAQEWQIVVTGLIIILAVYGDILRRKKS