Protein Info for BPHYT_RS20605 in Burkholderia phytofirmans PsJN

Annotation: LysR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 55 to 72 (18 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 153 to 154 (2 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 283 to 300 (18 residues), see Phobius details amino acids 306 to 322 (17 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details PF13515: FUSC_2" amino acids 246 to 368 (123 residues), 63.3 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4142)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEK4 at UniProt or InterPro

Protein Sequence (378 amino acids)

>BPHYT_RS20605 LysR family transcriptional regulator (Burkholderia phytofirmans PsJN)
MIPEDDRKIDADAQNRAASDGIRGEAAGEGGRGVIRSAATWLEQLDPGTHRRIKGLRLVT
AYGIAAALGTLQDVTHGLPGATLVGSLAGNFALWASVSEARVSRPESSRDLAFLCAAAVL
GAAMFIAFAPILQTLGAAGPELTLVTGAFLVGYLKRFGILGAGMGSQIFIGQLLAYNIHL
TPVDMPAVLVAGLIAMLASIVPRLLSGPAERPALTVLSPVDMPDRWKLSAELIMGLQAAS
GALVVVVLNETIGLKESAWAITASTYVVAGSASGTAERVRRRIIGTLVGVPLGLACLPLV
EHVPLLAWAAVAAAMIIYAMALPERYDIACGAFAVTLIVTLAIGGVHSISFLGARAWETL
LGGVVGLLAAKFIFPLRV