Protein Info for BPHYT_RS20530 in Burkholderia phytofirmans PsJN

Annotation: PA-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 51 (17 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details PF01569: PAP2" amino acids 59 to 166 (108 residues), 43.3 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 37% identical to YBJG_ECOLI: Putative undecaprenyl-diphosphatase YbjG (ybjG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4126)

MetaCyc: 37% identical to undecaprenyl pyrophosphate phosphatase (Escherichia coli K-12 substr. MG1655)
Undecaprenyl-diphosphatase. [EC: 3.6.1.27]

Predicted SEED Role

"phosphoesterase, PA-phosphatase related"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.27

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEI9 at UniProt or InterPro

Protein Sequence (200 amino acids)

>BPHYT_RS20530 PA-phosphatase (Burkholderia phytofirmans PsJN)
MQTLEAFNQALFLMIDATLSTPAWCIDFARSIADYLIYLVPLCLTAMWLSGDERQRETAL
RACCVTLLALGINQLIGLVWPQPRPFVLGIGHTFLDHAPDPSFPSDHGTIFASIALTLLL
GGVKRYGSLIVLSGLAVAWARIFIGVHFPLDMAGAVVVAAVAFMLVAPPWRLAGPSMTRG
LIALYRKLLAWPIERGWLSL