Protein Info for BPHYT_RS20435 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 19 to 224 (206 residues), 80.8 bits, see alignment E=1e-26 amino acids 244 to 428 (185 residues), 44.7 bits, see alignment E=9.1e-16 PF07690: MFS_1" amino acids 24 to 383 (360 residues), 93.4 bits, see alignment E=1.3e-30 amino acids 249 to 422 (174 residues), 36.1 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4107)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEH0 at UniProt or InterPro

Protein Sequence (458 amino acids)

>BPHYT_RS20435 MFS transporter (Burkholderia phytofirmans PsJN)
MIQDTQQGTHAAMRTRAVTAAAVGTALEWFDFTLYGALAATVLPKLFFPSMDSTSALLAS
LATFGVGLAARPLGAIICGHLGDKLGRRNLMLGTVTVMGLASMLMGLLPTYASIGVWAPV
LLVLLRILQGFALGGESTGAQLMAIEHASADRRGKYSGLLGLCSPLSQIMANGVLLLLSS
MMSAQAFDSYGWRIPFILSFILVVVGVYIRLRVSETPAFVALRKTEVVHVGSPLRDALRL
HWRTVLRWMLFFCGPAAIFYLIVVFSLSYITKTLAIPKQTGFLLLMGANVCAIVGALAGG
MLSDKIGRKKALAIGSIATLLMLFVYFQILDTKSFVPMLAAMGFFLGFTQFQSGIQPVAF
AEAFPTNVRYSGSALAYTGANLVAGGPMPVLAVWLFSVCNGSPWGVVAVCVVFNVISLVM
ILTARETLGIDMNRTDSTAAVTGEADFTPAHVSNSHRT