Protein Info for BPHYT_RS20370 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 327 to 349 (23 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details PF07690: MFS_1" amino acids 45 to 343 (299 residues), 105 bits, see alignment E=2.1e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4094)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEF7 at UniProt or InterPro

Protein Sequence (422 amino acids)

>BPHYT_RS20370 MFS transporter (Burkholderia phytofirmans PsJN)
MDANQLAGSSARPALASDSALDAPLVSTGAAASRGASWAAVLSVAVGSFAFVATEYMPVG
LLPQIAHDLGVTPGTAGLMVTTPGIIAAISAPALLLAAGRINRRLILLLLAALLVASNAI
SAIAPSFAVMLVGRALLGASLGGFWTVALGASGQLVREDQAARAGATIFMGITLATVIGV
PLGTLIADLSSWRVSFFATAVLAGVALAAQVVFLPSLPPKAAMRTDDFRAMLARSNVRRS
LWMVGLLFGAHFAAYTYIAPFLERNAAFGPSWITAVLLGFGVVGFAANFAISALVTRHLK
VSLLMLGALMAAALFALPMLQVSRVGVIAAVMAWGIAYGAIPLSLSIWMQWTSPERPEAG
SSMFVSTVQTSIALGSLAGGAVVDHLSIASTMHFGGLLAVLSLLVIMTFSTRHASLKDVL
DK