Protein Info for BPHYT_RS20350 in Burkholderia phytofirmans PsJN

Annotation: citrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 175 to 194 (20 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details TIGR00784: citrate transporter" amino acids 1 to 434 (434 residues), 395.4 bits, see alignment E=2.1e-122 PF03600: CitMHS" amino acids 16 to 369 (354 residues), 91 bits, see alignment E=4.1e-30

Best Hits

KEGG orthology group: K03300, citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family (inferred from 100% identity to bpy:Bphyt_4090)

Predicted SEED Role

"Uncharacterized transporter, similarity to citrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEF3 at UniProt or InterPro

Protein Sequence (434 amino acids)

>BPHYT_RS20350 citrate transporter (Burkholderia phytofirmans PsJN)
MLPLLGLATIVVLLGAILSKRMSPLVALIIVPIAASLIGGFGFQTSKFVIDGLKNLAPVV
GMFVFAILYFGTITDAGTLDPIIDRILRAVGTRPTRIVMGTTLLALLIHLDGSGAVCFLV
TIPAMLPLYDRLKMDRRVLAAAVSMAAGINFLPWTGPMIRASASLHLPISALFNPLIPVQ
AIGLVFVFGMAFWLGRREEKRLGLTAASGSVPMPKRELSPEEQALRRPKNFWFNIVLTLV
VLGTMVVMGEKVPPAIMFMVGLCIALMVNYPNVDMQRKRIDAHARAALMMAGILLAAGVF
TGVMQGSGMLKAMAQAAVGFVPPAMAGHIPVALGLLSMPLSMLFDPDSFYFGVLPVIAEV
AGQLGVPAVHVGQAALLGQMTTGFPVSPLTPATFLVVGLCGIDLADHQKFTFPLLFGASV
VMTIACVVLGIFSL