Protein Info for BPHYT_RS20295 in Burkholderia phytofirmans PsJN

Annotation: ligand-gated channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details PF07715: Plug" amino acids 84 to 185 (102 residues), 48.2 bits, see alignment E=1.4e-16 TIGR01783: TonB-dependent siderophore receptor" amino acids 86 to 727 (642 residues), 309 bits, see alignment E=3.8e-96 PF00593: TonB_dep_Rec" amino acids 282 to 697 (416 residues), 127.1 bits, see alignment E=1.7e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4079)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEE2 at UniProt or InterPro

Protein Sequence (727 amino acids)

>BPHYT_RS20295 ligand-gated channel (Burkholderia phytofirmans PsJN)
MQKFFVAGRPAFVRGPRRTPSLLSAGLLASVGLTLSTLSTSGWAQVAASDAGTTLPAVSV
SAAKDTTVAQADTISAGALGSRKQVDTPFSTHVVTSDEAQDLFATTANDLYKYDPAVSVI
SDNGVSENSMFTVRGMPIDTLNSVKVDGQTFPSWDTDLSLEPFEQVELLKGLSGFMYGFG
SPGGIVNYVLKRPTDTPYRSISVGYKSAGVFSEAVDLGGRFGNDDRFGYRLNLANENGNT
AEDHGHVRRQVASLAFDFRITPDLTWSADAFYQKRRTNGTLFGLMFGGDAGGIPDASKVT
HALTQPQNYYETEMASFGTGLDYRISENWHASIKYRFAKENRTNSDSFLFVTDPAGNYSN
TLYAALTRYFYQNVDGMVQGHFNTGTIKHDVVVGAGFLTQTSEYSNSTGWNEGYFLGNGN
LYASTLLTNDEVSISSNLYRQQRTTQAAVYASDTVQLTSRLAALVGVRYTQYQQHVYDPS
GAVSSQYQADPVTPTFALMFKTDPYSTLYVSYVESLEQGGAASNTNLNYPDTFGPLRSKQ
YEVGFKTDHAKWGANLALFRVDQGYNYTNVDNIFVQDGTKRYQGLDASGWLAVTSEWRVL
GGVMWLDTKAMDVNDPTVEGKRIYGAPRFTVTGRIEYNPSYLRPLTLAFGGKYVGNQAVD
AQNTQFVPAYTTFDLSGRYETKIAGKDVTFRAGINNLFNRRYWTTAWGYYVAPSATRTAV
ASATLQF