Protein Info for BPHYT_RS20215 in Burkholderia phytofirmans PsJN

Annotation: RNA polymerase sigma 70

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF04542: Sigma70_r2" amino acids 53 to 114 (62 residues), 47.3 bits, see alignment E=1.5e-16 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 53 to 201 (149 residues), 63.6 bits, see alignment E=8.8e-22 PF08281: Sigma70_r4_2" amino acids 149 to 199 (51 residues), 31.3 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to bpy:Bphyt_4063)

Predicted SEED Role

"DNA-directed RNA polymerase specialized sigma subunit, sigma24-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEC6 at UniProt or InterPro

Protein Sequence (223 amino acids)

>BPHYT_RS20215 RNA polymerase sigma 70 (Burkholderia phytofirmans PsJN)
MAEVLVRREPSTAMPISVLNAAGACPPVSRRTRNHARAVDWEKGTLLDVLIDNRPMLVNL
ARGFVGCASLAEDVVHDVFIKLVDFPDQDAVRQPVAYVTRMVRNASIDAFRRQSLENTYH
ADEDDGLHVPSPEPSPEAALLVRDTLRHVYNALEQLPARSRAAFEMVRLREETLQNTARA
LDVSQTLVHFMVRDAEKHCADCLDACNRGVAGPAFCSGRARRR