Protein Info for BPHYT_RS20190 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 301 to 323 (23 residues), see Phobius details amino acids 345 to 362 (18 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details PF04140: ICMT" amino acids 308 to 396 (89 residues), 29.5 bits, see alignment E=8.2e-11 PF06966: DUF1295" amino acids 327 to 406 (80 residues), 22.9 bits, see alignment E=5.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4058)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEC1 at UniProt or InterPro

Protein Sequence (422 amino acids)

>BPHYT_RS20190 membrane protein (Burkholderia phytofirmans PsJN)
MNSTFDTVARVHDPRPRSATPFSIGLLGIAVGLLTLWLLRDSSSFDGATRSTVACLAIIA
TIAAYELFVARVYLRPSAGLASRAVRPLSIVRVELRLAALASVYAGIGALYWLLPEYHGA
FYNPFWSLLGTLAPYVLIAAPFYFAWMDRHQRETDDAYLLWARFLFRGERPANWRPVREM
LAGWMVKAFFLPLMIVYLSTNADHLDASLTTALNAPFSLATFRFMYDLSFAMDLMFGTVG
YLCTLRILDSHVRSAEPTVLGWLVALICYQPFWSLISNQYIHYEGSVFWDNWLISMPVVR
VVWGAVIVALLLCYALTTISFGLRFSNLTNRGIITSGPYRFTKHPAYIAKNLSYWMVTVP
FIEPLGWRAAVTHCAALLAVNMLYFLRAKTEEKHLMNDSEYREYAAWIARNGVFARLSRV
FD