Protein Info for BPHYT_RS20160 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 38 to 53 (16 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 223 to 265 (43 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4051)

Predicted SEED Role

"FIG00462732: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEB4 at UniProt or InterPro

Protein Sequence (443 amino acids)

>BPHYT_RS20160 hypothetical protein (Burkholderia phytofirmans PsJN)
MKQGNANAVRRRLRFDALAGAVSVERIEALICTGSPGLYRVVVFFAVQHVYSLAELGRTA
SSMSIAQMVAFFTAIGWATLILVRVPAATTEQGAIAVFYRVATMSLATTVLCTLLALTIA
FFKTVQFDLPAFVALLWGWTAYQIARHYFVALKRFRIAIAFDIALIASSGGMLALCHRGG
LSADNAVAMALGAIAIAMFVRIGRPALDVLPKRLDTEGLQFGLTNFLSGGIQLVFVPAAT
IMCGAAFAGMLSLLSSVTAIGMLLPRAISMTQLADLAKRKAASLSLDDSLHTMSRNIGWC
NGAMLVFNVILVLLLAARPVHGAAHQSGIIVAGLLLAIQCAVGMMGIANSSIMMVFERGG
SAAKINIFTTSAFALLAVPCYAYGGQSGLMMILCAAIAVTVWRNWLIRCCARQIHSRYVD
LCGSAAVSDVKCQVQPLACGASR