Protein Info for BPHYT_RS20150 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF13439: Glyco_transf_4" amino acids 33 to 160 (128 residues), 28.8 bits, see alignment E=3e-10 PF20706: GT4-conflict" amino acids 132 to 300 (169 residues), 48.9 bits, see alignment E=1.2e-16 PF00534: Glycos_transf_1" amino acids 179 to 328 (150 residues), 126 bits, see alignment E=2.9e-40 PF13692: Glyco_trans_1_4" amino acids 179 to 320 (142 residues), 115.8 bits, see alignment E=4.9e-37 PF13524: Glyco_trans_1_2" amino acids 261 to 348 (88 residues), 31.9 bits, see alignment E=3.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_4049)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TEB2 at UniProt or InterPro

Protein Sequence (363 amino acids)

>BPHYT_RS20150 glycosyl transferase family 1 (Burkholderia phytofirmans PsJN)
MSIRVLQVGPGHGQQGGIASVLSQLARSREQFGRAGVAVSFFETRGFRNLGDLLAFALID
MPSFVRATIRADVVHFHVSERGSFYRKFALFVVARLLGKRTVFQLHSGNFERFIQDADRV
TRLLAGLFIDKTDCVIAVSTPIAKCLQHWRRTDAVQVVGNMALDAEHGAPTATPLACSRP
YIAFAGRLSEAKGLDELIRAVADLVRRGRDIEVRVAGTGDMLRWQRIAAAHGLDERVVFE
GWLDGNAKLAFYRGARLFCMPSHFESFGIATLEAMFCGLPVVGTRLGGFLDLVEDGVSGY
LVDGHDSRGLAEAICKLVDDPEHAMRMGCVGLVRAQTCFRAASIVDRYVDCYRRVDTRGR
SER