Protein Info for BPHYT_RS20085 in Burkholderia phytofirmans PsJN
Annotation: mannosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to Y412_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0412 (MJ0412) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 99% identity to bxe:Bxe_B0494)MetaCyc: 39% identical to taurine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]
Predicted SEED Role
"ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component" in subsystem Alkanesulfonate assimilation
Isozymes
No predicted isozymesUse Curated BLAST to search for 7.6.2.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2TE99 at UniProt or InterPro
Protein Sequence (264 amino acids)
>BPHYT_RS20085 mannosyltransferase (Burkholderia phytofirmans PsJN) MNQPLSRDTPAIEMRNVSCRFISPDGKATIALRDFSMSVARGEFVAVVGPTGCGKSTTLS MITGLLKPTTGEVRVMGAPVDGIDPRIGFVFQADAVFPWRSVLDNVAAGPLYRGRSKSAA YDEANEWLRRVGLDKFGKHYPHQLSGGMRKRVALAQTFINKPEILLMDEPFSALDMQTRT LMQDELLQLWGGAGSVVFVTHDLEEAIALADRVFVLTARPATLKKVYEIDLPRPRVTSEI RYEPRFIEISRDIWHDLREEVQIG