Protein Info for BPHYT_RS19810 in Burkholderia phytofirmans PsJN

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 signal peptide" amino acids 1 to 11 (11 residues), see Phobius details transmembrane" amino acids 12 to 27 (16 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 4 to 181 (178 residues), 64 bits, see alignment E=2e-21 PF00672: HAMP" amino acids 207 to 258 (52 residues), 43.5 bits, see alignment 4.7e-15 PF00015: MCPsignal" amino acids 357 to 504 (148 residues), 115.7 bits, see alignment E=3.2e-37

Best Hits

KEGG orthology group: K13487, methyl-accepting chemotaxis protein WspA (inferred from 100% identity to bpy:Bphyt_3979)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7T5 at UniProt or InterPro

Protein Sequence (541 amino acids)

>BPHYT_RS19810 chemotaxis protein (Burkholderia phytofirmans PsJN)
MKQWTIRQRILCSFGIVLIVMLAMAIVTFEQLGGIDRDAKSQQEDSMPGLYYATAMRAAW
FENYTVTQRLVYVDADPESVKRDTERLQDTEQTLQKLLGDYGATIFRDNDRGFFNDFRQQ
HTQYLPIQASLLNALPSSKENAVRIFNTQLTPIWEAGRLSARKLVDNNKADADKAAESIR
SSVEATRIVLLVMLLIAAIVAVLAGYWLLRAVTTPMAKVLRVVDVMRTGDLTQRLQLNRA
DEIGALEAGFNRMTDELTALVGQAQKSAVQVTTSVTEIAATSREQQATANETAATTTEIG
ATSREIFATSRDLLRTMNEVSEVAGQSAALAGTGHAGLARMEETMRLVMEAAGSVNAKLA
ILNEKASNINQVVATITKVADQTNLLSLNAAIEAEKAGEYGRGFAVVATEIRRLADQTAV
ATYDIEQMVKEIQSAVAAGVMGMDKFSEEVRRGMLDVQNVGGHLTQIIQQVQQLAPRFSM
VNEGMQTQATGAEQITQALTQLSEAAQQTAESLRQSTQAIDDLTHVANSLRTGVSRFKVT
A