Protein Info for BPHYT_RS19790 in Burkholderia phytofirmans PsJN

Annotation: peptidase M23

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 804 PF01627: Hpt" amino acids 10 to 98 (89 residues), 52.1 bits, see alignment E=1.3e-17 PF02518: HATPase_c" amino acids 382 to 521 (140 residues), 56.7 bits, see alignment E=6.1e-19 PF01584: CheW" amino acids 528 to 656 (129 residues), 59.9 bits, see alignment E=4.3e-20 PF00072: Response_reg" amino acids 683 to 795 (113 residues), 86.7 bits, see alignment E=2.5e-28

Best Hits

KEGG orthology group: K13490, two-component system, chemotaxis family, sensor histidine kinase and response regulator WspE (inferred from 100% identity to bpy:Bphyt_3975)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7T1 at UniProt or InterPro

Protein Sequence (804 amino acids)

>BPHYT_RS19790 peptidase M23 (Burkholderia phytofirmans PsJN)
MTDDPRRPSLIDLFREEARTQARVLNDGLLALDRAPRDAAALEACMRAAHSLKGAARIVG
VQVGVELAHAMEDCFVAAQEGRALLDAAWIDELLRGVDIVARIGNDEDESARDAVGTCVA
ALQARMAGVPPHGAAIRRDTTPPATAAVIESPAIALGVNANPDPDAVFNSLADALRAEAR
PADATPAPTQDDNAALAPAQKQHDPFAAPFASNSTTIAPATEPGRMLRVRADNLDRLLSL
SGESLVESRWLKPFAQSMLRIKRVQRDGTRALDQLHETLADLKLDPRAQAALEELRRLTA
ESQHMLAERLADLESFDRRSTHLSQQLYDAALQCRMRPFGDGTSGLARMVRDVARSLGKK
MRWQLVGESTQVDRDILDLLEAPLGHMLRNALDHGIEAPAVRLARGKPEEGTLTLDARHT
AGTLLITVSDDGAGIDLDALRASVVRKKLASEETVARLSEAELLEFLLLPGFSLRDQVTE
VSGRGVGLDAVHDVVKRVRGTVRITHEPGLGTRVQLQLPLTLSVIRSLLVEVAGEPYAVP
LAHVNRTLHVNRAEIELLEGHQHIAFSGRRIGVVTAHQILDAAPPADEGRTVSMIVIGDG
SQTYGVVVDRFLGERMLVVQPLDPRLGKIRNITAGALMENGDPVLIADVDDWLRSVERLV
AGGDLKHTQHGDARAAQRATRRVLVVDDSLTVRELERKLLATRGYDVTIAVDGMDGWNAV
RGERFDLVITDIDMPRMDGIELVTLIKRDPQLQSLPVMIVSYKDREEDRRAGLNAGADYY
LAKGSFHDEALLDAVRDLIGEAYG