Protein Info for BPHYT_RS19785 in Burkholderia phytofirmans PsJN

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00072: Response_reg" amino acids 4 to 103 (100 residues), 60.4 bits, see alignment E=1.8e-20 PF01339: CheB_methylest" amino acids 155 to 331 (177 residues), 199 bits, see alignment E=5.3e-63

Best Hits

Swiss-Prot: 68% identical to CHEB4_BURTA: Protein-glutamate methylesterase/protein-glutamine glutaminase 4 (cheB4) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: K13491, two-component system, chemotaxis family, response regulator WspF [EC: 3.1.1.61] (inferred from 100% identity to bpy:Bphyt_3974)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7T0 at UniProt or InterPro

Protein Sequence (338 amino acids)

>BPHYT_RS19785 chemotaxis protein CheY (Burkholderia phytofirmans PsJN)
MKIGIVNDMPLAVEALRRALAARHDYEVLWIAQDGQQAIDFCTAQRPDIVLMDLVMPNVD
GIEATRRIMARAPCAILVVTVDVGANAWRVYEAMGAGALDAVDTPSLNGPDAHKSIATLI
AKIDRIAALVKERNAPGAAAATAPACVTNRDTPLVAIGASAGGPAALATLLAGLPKDFAA
AIVIVQHVDAAFAAGMADWLNQQSAVPVRIAREGDRPQAGVALLAATDDHLHLKLPNVLG
YTRVPEETPYRPSVDVFFHSVVARWPARAVGVLLTGMGRDGAIGLKAMRTKGYHTIAQDE
ATSAVYGMPKAAAALDAAAAILPLPRIAAALVTAVDAR