Protein Info for BPHYT_RS19780 in Burkholderia phytofirmans PsJN

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF00072: Response_reg" amino acids 47 to 160 (114 residues), 72.5 bits, see alignment E=3.1e-24 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 193 to 361 (169 residues), 168.6 bits, see alignment E=4.8e-54 PF00990: GGDEF" amino acids 198 to 357 (160 residues), 161.1 bits, see alignment E=2e-51

Best Hits

KEGG orthology group: K11444, two-component system, chemotaxis family, response regulator WspR [EC: 2.7.7.65] (inferred from 100% identity to bpy:Bphyt_3973)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7S9 at UniProt or InterPro

Protein Sequence (362 amino acids)

>BPHYT_RS19780 diguanylate cyclase (Burkholderia phytofirmans PsJN)
MDTPKPHQNAAAQDFASDAVDAPNLAIDDALARILGNPPAAECPIMVLLVDDQAIIAEAI
RQALADEPSVDFHYCASPEEALRSAAETRATVILQDLVMPGTDGLTLVRQYRQNAATRDI
PIIVLSTKEEPLVKSAAFAAGANDYLVKLPDRIELIARIRYHSRSYLNLIQRDEAYRALR
QSQQQLLATNLELQRLTHSDGLTGLSNRRYLDQYLAAEWRRSTREKTGLGFLMIDVDNFK
AYNDTYGHVAGDEVLKTVAHTVESCLGRPADLAARFGGEEFAVVVPGTSSGGLRLLAEKI
RIAIEGLAIPHSGSATGIVTISIGAATLVPTVAEPVTKLIEAADVGLYRAKRDGKNQVAV
SD