Protein Info for BPHYT_RS19670 in Burkholderia phytofirmans PsJN

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 63 to 83 (21 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 282 to 305 (24 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 490 to 508 (19 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 25 to 506 (482 residues), 542.7 bits, see alignment E=4e-167 PF07690: MFS_1" amino acids 30 to 424 (395 residues), 199 bits, see alignment E=1.1e-62 PF00083: Sugar_tr" amino acids 47 to 198 (152 residues), 41 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 53% identical to EMRB_ECOLI: Multidrug export protein EmrB (emrB) from Escherichia coli (strain K12)

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to bpy:Bphyt_3951)

MetaCyc: 53% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7Q7 at UniProt or InterPro

Protein Sequence (520 amino acids)

>BPHYT_RS19670 DSBA oxidoreductase (Burkholderia phytofirmans PsJN)
MNATASAAALPAAEPAPLKGGALALLTVGLALGTFMEVLDTSIANVAVPTISGSLGVATS
QGTWVISSYSVASAIAVPLTGWLARRVGEVKLFTLSVLLFTIASALCGFAHNFESLIAFR
LVQGLVSGPMVPLSQTILMRSYPPEKRGLALGLWAMTVICAPIFGPVMGGYITDNYTWPW
IFYINVPIGLFSAVCAFLLLRGRETKTTKQRIDAVGLALLVIGVSCLQMVLDLGKDRDWF
NSTFIVTLAVIAVISLAFMLVWEMTEKEPVVDLSLFKDRNFALGVVIVSFGFMAFFGSVV
IFPLWLQTVMGYTAGLAGLATAPVGLLALFLSPMIGKNMHRLNLRVVASFAFIVFAFVSF
WNSTFTLDVPFNHVIWPRLVQGIGVACFFVPMTTITLSSVPDERLASASGLSNFFRTLSG
AIGTAISTTYWENDTIRHHAMLTDSVNVYAANTNAYTDSLAGLGLSGDGITAQLNQVVTA
QAYMMATNDFFRISCAAFLVLAALVWVTKPRKGVGPSMGH