Protein Info for BPHYT_RS19540 in Burkholderia phytofirmans PsJN

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details PF08521: 2CSK_N" amino acids 21 to 159 (139 residues), 91.9 bits, see alignment E=6.1e-30 PF00512: HisKA" amino acids 238 to 302 (65 residues), 45.3 bits, see alignment E=1.1e-15 PF02518: HATPase_c" amino acids 354 to 472 (119 residues), 90.9 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3925)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7N1 at UniProt or InterPro

Protein Sequence (501 amino acids)

>BPHYT_RS19540 sensor histidine kinase (Burkholderia phytofirmans PsJN)
MPQPAANSLRRTLLRRLAAPLSLLALMSGLIAYWLAWQYTQHVVDRSLADLATAISKQIQ
IAGPNARITVPPLAQAMFSDPVEHLVYRISTGETEIAGDHNLPLQGTSVRRMHYAYVFET
QHQGVTVRVAQVRVDQPTGNPIVVEVGQPVHHRFRIAAEFLVAIMMPLLLLLLAGWVIVW
RVVNQQLNPLTDLADSLNRQTHTSLEPVDETYVPVEIRPLTGALNALLGRLKTALDGQRK
FIADAAHQLRTPLTAVKLHAEQAAVARDPQQTLAAVRELRAAADRAVRLSNQLLSLARAE
PGEQAARFVNVDMAALAFDTGAEWVPRALTFHVDLGFQRLDDPSNGHPLMARGNPVLLHE
VIANLLDNALKYVPPSRFDGGRITVTVSQTAIDEVRMAEIIVEDNGPGVPHNQQADLFKR
FFRGDGQSDAGVDGGAGLGLAIVHDIMVLHHGSVHYEDAPEGGARFIVRIPLVPISVESD
VETVEPRRPAKKSAHSAPVDI