Protein Info for BPHYT_RS19455 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 18 to 40 (23 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 253 to 276 (24 residues), see Phobius details amino acids 288 to 311 (24 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 335 (324 residues), 59.4 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_3908)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7L4 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BPHYT_RS19455 ABC transporter permease (Burkholderia phytofirmans PsJN)
MDLSIAAILAQDGITTGAIYALLALALVLVFSVTRVIFIPQGEFVSYGALTLAALQTQKF
PATCWLLMAMGAACFVVEIAGLVRHPERRRHAARTLVMLVGKYLLFPIAVYALTQGVFMH
TLPMIAQIALTLLIVIPMGPYVYRLAYEPIAEATTLLLLIVAVAVHFAMVGLGLVMFGAE
GSRTTAFSDATFNIGTLTISGQSLWVVGTAVVLIGALYLYFDRSISGKALRATSVNRLGA
RLVGIGTTQAGRLAFTLAAGLGALCGILVAPLTTIYYDSGFLIGLKGFVGAIIGGLVSYP
LAAAGSILVGLLESYSSFWASAYKEVIVFTLIIPVLLWRSLASPHAEEEEE