Protein Info for BPHYT_RS19435 in Burkholderia phytofirmans PsJN

Annotation: 16S rRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF02527: GidB" amino acids 32 to 218 (187 residues), 167.2 bits, see alignment E=5.1e-53 TIGR00138: 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG" amino acids 37 to 220 (184 residues), 157.2 bits, see alignment E=1.8e-50

Best Hits

Swiss-Prot: 95% identical to RSMG_PARXL: Ribosomal RNA small subunit methyltransferase G (rsmG) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03501, ribosomal RNA small subunit methyltransferase G [EC: 2.1.1.170] (inferred from 100% identity to bpy:Bphyt_3904)

Predicted SEED Role

"rRNA small subunit 7-methylguanosine (m7G) methyltransferase GidB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.170

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7L0 at UniProt or InterPro

Protein Sequence (227 amino acids)

>BPHYT_RS19435 16S rRNA methyltransferase (Burkholderia phytofirmans PsJN)
MTVSEKGSGRDALAPLLADGVRELGLDLSDAQLDKLLDYVALLSKWNAVYNLTAIRDPRQ
MLIQHILDSLSIVPHLAPLGPSSVLDVGSGGGLPGIVLAIVLSEWTVTVNDIVHKKTAFQ
AQAKAELGLANLSVVTGRVETLQPGAEVPAKFDVIVSRAFAELADFVTLARHLVAEQGAI
WAMKGVRPDGEIERLPVGAHVEQIIRLNVPSLDAERHLIKVLVDAGS