Protein Info for BPHYT_RS19365 in Burkholderia phytofirmans PsJN

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to DCUP_PARPJ: Uroporphyrinogen decarboxylase (hemE) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 100% identity to bpy:Bphyt_3890)

MetaCyc: 62% identical to uroporphyrinogen decarboxylase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

superpathway of heme b biosynthesis from glutamate (10/10 steps found)
superpathway of heme b biosynthesis from glycine (7/8 steps found)
heme b biosynthesis I (aerobic) (4/4 steps found)
heme b biosynthesis II (oxygen-independent) (3/4 steps found)
heme b biosynthesis V (aerobic) (3/4 steps found)
superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)
3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (4/9 steps found)
3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (4/9 steps found)
heme b biosynthesis IV (Gram-positive bacteria) (1/5 steps found)
3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (3/9 steps found)
superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7J6 at UniProt or InterPro

Protein Sequence (366 amino acids)

>BPHYT_RS19365 uroporphyrinogen decarboxylase (Burkholderia phytofirmans PsJN)
MAHKLLNDTFLRALLRQPTDYTPIWLMRQAGRYLPEYNATRGRAGSFLGLAKSPAYATEV
TLQPLDRYPLDAAILFSDILTVPDAMGLGLEFVTGEGPKFVRPVRTEDDVARLAVPDIDA
TLRYVTDAVREIRTALTDAQGRQRVPLIGFSGSPWTLACYMVEGGGSADFRTVKSMLYAR
PDLMHRILDVNARSVAAYLNAQIEAGAQAVMIFDTWGGALADGVYQRFSLQYIQQVVSQL
KRDHGGEKVPVITFTKGGGLWLDEIAETGVDAVGLDWTVNLSKARERVGGKVALQGNIDP
SVLFAPPASIRMEARAVLDSFGNHPGHVFNLGHGISQFTPPENVAELVDEVHRHSRAIRS
GAHAPA