Protein Info for BPHYT_RS19165 in Burkholderia phytofirmans PsJN

Annotation: sodium/hydrogen exchanger

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 74 to 99 (26 residues), see Phobius details amino acids 119 to 135 (17 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 8 to 162 (155 residues), 50.8 bits, see alignment E=9.4e-18 amino acids 196 to 333 (138 residues), 62.8 bits, see alignment E=1.9e-21

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 100% identity to bpy:Bphyt_3848)

Predicted SEED Role

"Ca2+/Na+ antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7F1 at UniProt or InterPro

Protein Sequence (336 amino acids)

>BPHYT_RS19165 sodium/hydrogen exchanger (Burkholderia phytofirmans PsJN)
MTGLLLELAIMLVVILVAAELFTNALEHLGERLKISEGVTGSLFAAVGTALPETLVPLLA
IASGTTDSAVNQEIGVGAILGAPLMLSTLSTFLMTLAILGSRGARGWVAPERTGFTRDLN
YFLCAFVLAAAAMYVPHEQMIVRALFSLALVGVYVTYVVMTFRASNELVDAGHGTEAPGK
MLISRLGVPTNLATIVVQLALAVALLVWGAEGFIHGVRGVSQALGVSPLLLSLLIIPIAT
ELPEKVNSILWIRRGKDTLAFGNITGAMVFQGTLLPAIGILLTPWVPRIEVVTGILITLV
AAAWLRVNVRERGVPVWASLVCGVLYATYLAITLSR