Protein Info for BPHYT_RS19110 in Burkholderia phytofirmans PsJN

Annotation: 3-oxoacyl-ACP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00195: Chal_sti_synt_N
  • amino acids 44 to 179 (136 residues), 31.3 bits, E=2.2e-11
• PF08545: ACP_syn_III
  • amino acids 117 to 196 (80 residues), 78.8 bits, E=3.4e-26
• PF08541: ACP_syn_III_C
  • amino acids 257 to 345 (89 residues), 99 bits, E=2.1e-32

Best Hits

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to bpy:Bphyt_3837)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (50/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

See B2T7E4 at UniProt or InterPro

Protein Sequence (346 amino acids)

>BPHYT_RS19110 3-oxoacyl-ACP synthase (Burkholderia phytofirmans PsJN)
MTSTVRSDRVQARILDIAGFLPERILTNEQLAALYPEWPADKILAKTGIQQRHIASAEQT
AADLAYEAARKLFAQGAVNAQDVDFVILCTQAPDYVLPTSACLLQDRLGIATHAGALDVN
LGCSGYVYGLSLAKGLVETGAARCVLLLTADTYSKYVHPLDKSVRTLFGDGASATAITAA
TDGDASIGPFVFGTDGRGAQNLIVKAGLFREPKSAQSALETTDASGNVRTDEHLYMNGAE
VMAFSLAEVPKAATALLEKAGMDREEIDFFVLHQANRFMLEALRKKMKVPEAKFPILMEQ
CGNTVSSTVPLALKQMKDDGLLTHGSRLMLLGFGVGYSWAGCMVTY