Protein Info for BPHYT_RS18900 in Burkholderia phytofirmans PsJN

Annotation: flagella basal body P-ring formation protein FlgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 305 to 377 (73 residues), 69 bits, see alignment E=5.5e-23 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 368 to 503 (136 residues), 130.5 bits, see alignment E=2e-42 PF08666: SAF" amino acids 381 to 442 (62 residues), 43.5 bits, see alignment E=5.6e-15 PF13144: ChapFlgA" amino acids 381 to 502 (122 residues), 106.8 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 100% identity to bpy:Bphyt_3795)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T7A2 at UniProt or InterPro

Protein Sequence (504 amino acids)

>BPHYT_RS18900 flagella basal body P-ring formation protein FlgA (Burkholderia phytofirmans PsJN)
MDQPAFDPTHRANCAAAHRVGTGAGVARRAARTASRLLTRLVVNLAVWVAGGIVLLPATT
RAQEAGGPIVIPGPGEKNPAALADLAEHMQTAPAKRAGSAATLAAATAQSLTPNSTARDA
DSFTRAANASGSIVIPGAGEPPAAPQMIRTNFRPDANGVVTIPAPGSANANAMDGVARVN
VVPGSRQVVPVVVTPAPQANGARQAAGVQPVAANAPLNAAAGASTAAGFDSLASRGEPPQ
LGANGKAVLTRAAVAPVATATPAPATIGRRPAVRQVAPAVAQQNLRPATLAPAAPLSGQQ
DPEAIRSAALAFLQQQSAGLPGKVDITVAPAFPRGLADCTMLEPFMPSGARLWGRMTVGV
RCAGERPWTIYLQARISLHATYYLAARAMAPGEVLTAADLVARDGDLTGLPQAIVTDPSQ
AVGSVTLTRVAGGMPLRRDMLKSASAVSIGQTVRVVAAGEGFAISAEGSAMNNASPGQQV
RVKTANGQIISGIVKDGSTVEIQL