Protein Info for BPHYT_RS18850 in Burkholderia phytofirmans PsJN

Annotation: Flagellar brake protein YcgR 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF07317: PilZN" amino acids 27 to 130 (104 residues), 93.3 bits, see alignment E=8.7e-31 PF07238: PilZ" amino acids 133 to 246 (114 residues), 39.6 bits, see alignment E=5.8e-14

Best Hits

Swiss-Prot: 100% identical to YCGR1_PARPJ: Flagellar brake protein YcgR 1 (ycgR1) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3785)

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T792 at UniProt or InterPro

Protein Sequence (257 amino acids)

>BPHYT_RS18850 Flagellar brake protein YcgR 1 (Burkholderia phytofirmans PsJN)
MDTTQSNGQTDTQGQLHAQTAEGGNDFGRRNPLEIGVQLRNLVNRGDFLTVQYAGGQLVT
RLLEVDVRGRTFTFDWGALSDQNRGLLGAPRCQFHAQPDGVRVEFATATPRETRFEGLPA
FEADFPEVLFYVQRREYFRVDAPILDPYVCSGRLPEGDTFRFEVHDLSLGGVGMRTADER
VAELPMGTRLLDCELVLGALGRLSLDLQLVSHRSTALPNGTQRYQLGFRFLTLPGSAENT
LQRLITQLEMKRRSLVR