Protein Info for BPHYT_RS18825 in Burkholderia phytofirmans PsJN

Annotation: flagellar biosynthesis protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 54 (54 residues), see Phobius details transmembrane" amino acids 77 to 107 (31 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 80 to 276 (197 residues), 297 bits, see alignment E=3.1e-93 PF00813: FliP" amino acids 80 to 272 (193 residues), 274.6 bits, see alignment E=2.5e-86

Best Hits

Swiss-Prot: 67% identical to FLIP_SALTY: Flagellar biosynthetic protein FliP (fliP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 100% identity to bpy:Bphyt_3780)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T787 at UniProt or InterPro

Protein Sequence (277 amino acids)

>BPHYT_RS18825 flagellar biosynthesis protein FliP (Burkholderia phytofirmans PsJN)
MQFSLSSARHAHSARMSSTLSKVISAVRRVAPVGPIALAALMLALPTLSFAQAAGLPAFN
TSPGPNGGTTYSLSVQTMLLLTMLSFLPAMLLMMTSFTRIIIVLSLLRQALGTSTTPPNQ
VLVGLALFLTLFVMSPVLDKAYTDGYKPFSDGTIPMETAVNRGLAPFKTFMLRQTRESDL
ALFARISHAAPMQGPEDVPLSLLVPSFVTSELKTGFQIGFTIFIPFLIIDMVVASVLMSM
GMMMVSPATISLPFKLMLFVLVDGWQLLLGSLAQSFV