Protein Info for BPHYT_RS18710 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 29 to 55 (27 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details PF04020: Phage_holin_4_2" amino acids 1 to 105 (105 residues), 129.7 bits, see alignment E=3.1e-42

Best Hits

Swiss-Prot: 41% identical to YVLD_BACSU: Uncharacterized membrane protein YvlD (yvlD) from Bacillus subtilis (strain 168)

KEGG orthology group: K08972, putative membrane protein (inferred from 96% identity to bxe:Bxe_A0179)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6X0 at UniProt or InterPro

Protein Sequence (117 amino acids)

>BPHYT_RS18710 membrane protein (Burkholderia phytofirmans PsJN)
MTLLLTWLINALALLIITYLVPSIHIRSFGTALIVAVVLGLINTVLRPVLILLTLPVTIL
TLGLFILVVNALCFWLCASLLKGFEVSGFWSAFIGSILYSIVSWLLSALIFGNRSLG