Protein Info for BPHYT_RS18465 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 71 (24 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 120 to 148 (29 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 245 to 262 (18 residues), see Phobius details amino acids 268 to 284 (17 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details PF07399: Na_H_antiport_3" amino acids 5 to 420 (416 residues), 577 bits, see alignment E=1.2e-177

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3706)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6S4 at UniProt or InterPro

Protein Sequence (420 amino acids)

>BPHYT_RS18465 membrane protein (Burkholderia phytofirmans PsJN)
MPHSVEISAAIIFAFALIHTFAVARIEKLSHRFPRHAGVFHFLAEVEVVFGFWALILCLV
MWALVGSHVTIEYLEHREFTEALFVFVIMVVAASRPILVLVTTIVMRLARFLPVRTQVAV
IWFSLSAVPLLGSIITEPAAMTLAALLLRDTLFSARSSERVKYFGLALLFVNVSIGGVMT
AYAAPPVLMVASAWGWSTGFMAATFGWKAALAVVFNATAFVALIARSVPTSQGSEGGTTS
PSQRVPVGVTLVHLGFLALVVINSHHAVVFIGAFLFFLGYTHAYERHQSPLMLRESLLVA
FFLGGLVVLGGLQQWWLQPIVRSMDALTLYFGATGLTAVMDNAAITYLGSLIPGLSDSAK
YLLVAGAVTGGGLTVIANAPNPAGLAILGNRFSGGAVSPIKLLGAALMPTIIAGLAFLVL