Protein Info for BPHYT_RS18360 in Burkholderia phytofirmans PsJN

Annotation: amino acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details PF01810: LysE" amino acids 15 to 207 (193 residues), 121.6 bits, see alignment E=1.5e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3684)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T6Q2 at UniProt or InterPro

Protein Sequence (211 amino acids)

>BPHYT_RS18360 amino acid transporter (Burkholderia phytofirmans PsJN)
MSLHTWWLFVATVFVVSAIPGPNMLLVMTHGAQHGLRRSSATMAGCLSALVLMLAVSAAG
LGVFLEAWPAMFNALRMIGAAYLMYLGIKAWRAPADEAAAGNADELAAKPARSRFALFRN
GFLVAGSNPKAILFAAALLPQFIDAAQPKLPQFGVLVATFAVIEVSWYLVYTGFGTRIGA
KLKSRSVARMFNRLTGGVFVGFGAMMALVRH