Protein Info for BPHYT_RS18180 in Burkholderia phytofirmans PsJN

Annotation: transcription antitermination protein NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF02357: NusG" amino acids 11 to 116 (106 residues), 107.7 bits, see alignment E=3.7e-35 TIGR00922: transcription termination/antitermination factor NusG" amino acids 13 to 185 (173 residues), 231.3 bits, see alignment E=3.1e-73 PF00467: KOW" amino acids 134 to 164 (31 residues), 29.9 bits, see alignment 3.5e-11

Best Hits

Swiss-Prot: 66% identical to NUSG_NEIMA: Transcription termination/antitermination protein NusG (nusG) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 96% identity to bac:BamMC406_0263)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T764 at UniProt or InterPro

Protein Sequence (185 amino acids)

>BPHYT_RS18180 transcription antitermination protein NusG (Burkholderia phytofirmans PsJN)
MSDTPASPSGKRWYVVHAYSGMEKSVQRALQERIERAGMQDQFGQILVPTEEVVEVKGGH
KSVTERRFFPGYVLVEMEMTDETWHLVKNTAKVTGFVGGARNRPSPISPREVEKIMSQMQ
EGVEKPRPKTLFEVGEMVRVKDGPFTDFNGSVEEVNYEKSRVRVSVTIFGRATPVELEFG
QVEKL