Protein Info for BPHYT_RS18000 in Burkholderia phytofirmans PsJN

Annotation: 30S ribosomal protein S13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 TIGR03631: ribosomal protein uS13" amino acids 3 to 114 (112 residues), 172.7 bits, see alignment E=1.5e-55 PF00416: Ribosomal_S13" amino acids 3 to 108 (106 residues), 105.5 bits, see alignment E=1.4e-34

Best Hits

Swiss-Prot: 100% identical to RS13_PARPJ: 30S ribosomal protein S13 (rpsM) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K02952, small subunit ribosomal protein S13 (inferred from 98% identity to bph:Bphy_2816)

MetaCyc: 68% identical to 30S ribosomal subunit protein S13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S13p (S18e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T728 at UniProt or InterPro

Protein Sequence (121 amino acids)

>BPHYT_RS18000 30S ribosomal protein S13 (Burkholderia phytofirmans PsJN)
MARIAGVNIPNHQHTEIGLTAIYGVGRTRSRDICVAAGVAFSKKVKDLNDADLEKLREEV
GKFIVEGDLRRETTMNIKRLMDLGCYRGVRHRKGLPLRGQRTRTNARTRKGPRRAAQSLK
K