Protein Info for BPHYT_RS17945 in Burkholderia phytofirmans PsJN

Annotation: cytochrome C biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 344 to 361 (18 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details TIGR03144: cytochrome c-type biogenesis protein CcsB" amino acids 162 to 399 (238 residues), 247.3 bits, see alignment E=1e-77 PF01578: Cytochrom_C_asm" amino acids 193 to 396 (204 residues), 166.7 bits, see alignment E=3e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_3609)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcsA/ResC" in subsystem Biogenesis of c-type cytochromes or Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T716 at UniProt or InterPro

Protein Sequence (401 amino acids)

>BPHYT_RS17945 cytochrome C biogenesis protein (Burkholderia phytofirmans PsJN)
MDLTQVSQSPSSRPQKALAGESLNIGEYDERPFLKRLGIVDWLFALAMVAGAGFALSRYH
PFMNYYDKLVLCCAVPVFVVLGWRWKPVRPLMVGIAALSLLAIQIYHGDLSRADNAFFLK
YFLSSQSAILWMSALFVFATVFYWIGLLSRSPTGAAIGSKMTWAAVVMGFVGLMVRWYES
YLIGADVGHIPISNLYEVFVLFSLITALFYLYYEQHYNTRALGAFVLLVISAAVGFLMWY
SVARDAQQIQPLVPALQSWWMKIHVPANFIGYGSFALSAMVGVAYLAKERGVLADRLPAL
EVLDDVMYKSIAVGFAFFTIATILGALWAAEAWGGYWSWDPKETWALIVWLNYAAWLHMR
LMKGLRGAVAAWWALTGLLVTTFAFLGVNMFLSGLHSYGKL